PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG364900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 781aa    MW: 84090 Da    PI: 6.0027
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG364900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2099155157
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                          +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  Pavir.7NG364900.1.p  99 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 155
                          688999************************************************995 PP

2START203.96.6e-642975181206
                          HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                          ela +a++elv++a+++ep+W         e +n++e+ + f+ + +      ++ea+r s vv+m+ a+lve+l+d++ q+ +++    
  Pavir.7NG364900.1.p 297 ELAVAAMEELVRMAQLDEPLWNAPGvdgssETLNEEEYSRMFSGGLGpkqygLKSEASRGSSVVIMTRANLVEILMDVN-QYATMFSsiv 385
                          57899****************98667777899**********555449999****************************.9999999999 PP

                          .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                           +a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+ds ++ +    v +++++pSg+li++++n
  Pavir.7NG364900.1.p 386 sRAATLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGTWAVVDVSLDSLRPGS----VLKCRRRPSGCLIQEMPN 471
                          9*****************************************************************97....8***************** PP

                          CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          g+skvtwvehv++++r++h+++++lv+sgla+ga++wv tl+rqce+
  Pavir.7NG364900.1.p 472 GYSKVTWVEHVEVDDRSVHNIYKQLVNSGLAFGARRWVGTLDRQCER 518
                          *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2284154IPR009057Homeodomain-like
SuperFamilySSF466895.43E-2084156IPR009057Homeodomain-like
PROSITE profilePS5007116.98996156IPR001356Homeobox domain
SMARTSM003898.3E-2097160IPR001356Homeobox domain
PfamPF000464.2E-1899154IPR001356Homeobox domain
CDDcd000861.46E-1999157No hitNo description
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084842.662288521IPR002913START domain
SuperFamilySSF559615.33E-37289520No hitNo description
CDDcd088756.06E-123292517No hitNo description
SMARTSM002346.4E-59297518IPR002913START domain
PfamPF018528.1E-53298518IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-6353515IPR023393START-like domain
SuperFamilySSF559615.5E-25539770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MMIPARHMRP MIGRSSAAAA YGSSSALSLG QPNLLDNHPQ LQQVLQQQHL LDQIPATPAE  60
RGGRSSDLLG DEFESKSGSE NVDGVSVDDQ DPNQPPSKKK RYHRHTQHQI QEMEAFFKEC  120
PHPDDKQRKE LSRELGLEPL QVKFWFQNKR TQMKNQHERL ENSQLRAENE KLRAENMRYK  180
EALSSASCPN CGGPAALGEM SFDEHHLRIE NARLHEEIDR ISAIAAKYVG KPMVSFPVLS  240
SPLAAARASP LDIGVGAAAA AAAYGATDIF GGVAGGAAGE LLRGAAQSDA DKPMIVELAV  300
AAMEELVRMA QLDEPLWNAP GVDGSSETLN EEEYSRMFSG GLGPKQYGLK SEASRGSSVV  360
IMTRANLVEI LMDVNQYATM FSSIVSRAAT LEVLSTGVAG NYNGALQVMS VEFQVPSPLV  420
PTRESYFVRY CKQNADGTWA VVDVSLDSLR PGSVLKCRRR PSGCLIQEMP NGYSKVTWVE  480
HVEVDDRSVH NIYKQLVNSG LAFGARRWVG TLDRQCERLA SVMASNIPTS DIGVITSSEG  540
RKSMLKLAER MVMSFCGGVT ASAAHQWTTL SGSGAEDVRV MTRKSVDDPG RPSGIVLNAA  600
TSFWLPVPPK RVFDFLRDES SRSEWDILSN GGIVQEMAHI ANGRDHGNCV SLLRVNSTNS  660
NQSNMLILQE SCTDSSGSYV IYAPVDVVAM NVVLNGGDPD YVALLPSGFA ILPDGPARGN  720
MQGSGGVGSG GSLLTVAFQI LVDSVPTAKL SLGSVATVNS LIACTVERIK AAVSGESNPQ  780
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.60661e-146callus| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976894.10.0PREDICTED: homeobox-leucine zipper protein ROC2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLK3Y5C10.0K3Y5C1_SETIT; Uncharacterized protein
STRINGSi009409m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2